IGF1 DES 50MG

igf1 des 50mg

Insulin-Like Growth Factor-1 DES (1-3) 20mg

Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 7,372 Da
Synonyms: IGF-1 Des(1-3), Des1-3, Des 1-3, Des (1-3), IGF-1 (4-70)

price is base on per vial

Important Notification: All of our products and services listed in this website are for research or production use only, not for direct human use.

IGF-1 DES 1,3 is a peptide that is secreted by the liver of animal test subjects. Its structure consists of a chain of 67 amino acids and, and it has a molecular weight of 7371.4. It contains a highly reactive structure, meaning that its processes are essentially geared toward building up muscle and tissue growth repair via various chemical reactions of complex molecules. It is occasionally referred to by different names, including:

• Somatomedin C
• IGF1
• IGF-1
• IGF1A
• Insulin-like growth factor 1

IGF-1 DES 1,3 at a Glance

The primary impetus of IGF-1 DES 1,3’s function is in its ability to promote hyperplasia, also known as hypergenesis. In essence, this condition is considered to be an internal process in which the proliferation and increase of cells within various parts of an animal test subject’s body are regulated. The reason for this particular process to manifest itself is related to various triggers that are initiated on an as needed basis. For example, hyperplasia could be initiated due to the body’s need for cells in order in a certain area to gain a semblance of stabilization, such as when a base layer of epidermis needs to be formed as a compensatory measure for naturally occurring skin loss. Another way that hyperplasia can be initiated is due to a sense of hormonal dysfunction, in which cell proliferation is needed in order to ward off specific ailments that could block the proper performance of an animal test subject’s endocrine system. The process could also be triggered as a response to a chronic inflammatory issue. Or it could be due to other forms of bodily compensation brought about via cellular loss that may occur due a host of diseases or damage that was incurred throughout the body. Because IGF-1 DES 1,3 has shown a capacity to initiate the process of hyperpalasia, scientific study based on animal test subjects has targeted its research to dissect its ability to control and regulate the development of tissue and the regulation of growth on a cellular level. Some aspects of this particular study have been expanded to determine the influence it may have on the area of neurological growth. These particular findings have been able to determine that the peptide doe contain the capacity to control and regulate both neuronal functionality and neuronal structure throughout the course of an animal test subject’s lifetime. These studies also have determined that it has an ability to maintain nerve cell function and can promote neuroregeneration; that is, the promotion of nerve tissue growth. This latter function has enabled scientific study based on animal test subjects to conceive that the peptide could play an instrumental role in the treatment of injuries relating to the central nervous system.

Other Beneficial Properties

Scientific study that has been based on animal test subjects has determined that the presence of IGF-1 DES 1,3 and its ability to promote hyperplasia could tie it to a few theorized benefits. The first of these particular benefits relates to an acceleration of muscle repair. Because IGF-1 DES 1,3’s mechanics allow it to initiate hyperplasia, scientific study based on animal test subjects has extended this ability to determine that the peptide can also increase the proliferation of cells that are needed to repair muscle tissue. Over time, this ability could turn into an ability to increase muscle growth. Another beneficial process can be tied to a slowing down of the aging process. Scientific study that has been based on lab rats has determined that IGF-1 DES 1,3’s ability to promote cell production slowed down the natural degradation of muscle fibers that regulate flexibility and elasticity in the skin and muscle. This process was shown to allow middle-aged and older rats to maintain a level of power and speed that was on par with similar functions found in younger rats. A third theorized benefit links IGF-1 DES 1,3 with the notion of an accelerated injury recovery rate. Scientific study that has been based on animal test subjects determined that IGF-1 DES 1,3’s capacity to promote cellular proliferation can cause a greater amount of cells to be produced in times when an animal test subject suffers an injury. As such, this type of proliferation can enable a much faster rate of healing to commence. Although there has been an extensive amount of research and study conducted in relation to IGF-1 DES 1,3 and its overall functionality, operational mechanics, and theorized benefits, it needs to be noted that all of the research that has been conducted and the subsequent results from such research has been solely built around the scientific study based on animal test subjects. Therefore, any findings or observations that relate to IGF-1 DES 1,3’s overall functionality, mechanics, or theoretical benefits, should only be contained to the strict confines of a controlled environment such as a medical research facility or a laboratory.