Wholesale IGF1 DES 2MG -50vials
Sale!

Wholesale IGF1 DES 2MG -50vials

$190.00

SKU: OR-PEP-IGF1 DES-2-MG-50

Wholesale IGF1 DES 2MG -50vials

PER GRAM: 2 mg

Price is base on: 50 vial

RAW MATERIALS ARE MADE BY THE USA

The chemicals/materials/peptides for sale here are intended for laboratory and research use only, unless otherwise explicitly stated. They are not intended for human ingestion, use, or for use in products that may be ingested.

- +
Add to Wishlist
Product Name: IGF1 DES
 Unit size: 2mg
 CAS NO.:
 Synonyms: IGF-1 Des(1-3), Des1-3, Des 1-3, Des (1-3), IGF-1 (4-70)
 Sequence:

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

 Purity: ≥99% (HPLC)
 Physical State: Lyophilized Powder
 Solubility: Soluble in water or 1% acetic acid
 Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C.

igf1 des 2mg

Insulin-Like Growth Factor-1 DES (1-3) 2mg

Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 7,372 Da
Synonyms: IGF-1 Des(1-3), Des1-3, Des 1-3, Des (1-3), IGF-1 (4-70)

price is base on per vial

Important Notification: All of our products and services listed in this website are for research or production use only, not for direct human use.

IGF-1 DES 1,3 is a peptide that is secreted by the liver of animal test subjects. Its structure consists of a chain of 67 amino acids and, and it has a molecular weight of 7371.4. It contains a highly reactive structure, meaning that its processes are essentially geared toward building up muscle and tissue growth repair via various chemical reactions of complex molecules. It is occasionally referred to by different names, including:

  • Somatomedin C
  • IGF1
  • IGF-1
  • IGF1A
  • Insulin-like growth factor 1

IGF-1 DES 1,3 at a Glance

The primary impetus of IGF-1 DES 1,3’s function is in its ability to promote hyperplasia, also known as hypergenesis. In essence, this condition is considered to be an internal process in which the proliferation and increase of cells within various parts of an animal test subject’s body are regulated. The reason for this particular process to manifest itself is related to various triggers that are initiated on an as needed basis. For example, hyperplasia could be initiated due to the body’s need for cells in order in a certain area to gain a semblance of stabilization, such as when a base layer of epidermis needs to be formed as a compensatory measure for naturally occurring skin loss. Another way that hyperplasia can be initiated is due to a sense of hormonal dysfunction, in which cell proliferation is needed in order to ward off specific ailments that could block the proper performance of an animal test subject’s endocrine system. The process could also be triggered as a response to a chronic inflammatory issue. Or it could be due to other forms of bodily compensation brought about via cellular loss that may occur due a host of diseases or damage that was incurred throughout the body. Because IGF-1 DES 1,3 has shown a capacity to initiate the process of hyperpalasia, scientific study based on animal test subjects has targeted its research to dissect its ability to control and regulate the development of tissue and the regulation of growth on a cellular level. Some aspects of this particular study have been expanded to determine the influence it may have on the area of neurological growth. These particular findings have been able to determine that the peptide doe contain the capacity to control and regulate both neuronal functionality and neuronal structure throughout the course of an animal test subject’s lifetime. These studies also have determined that it has an ability to maintain nerve cell function and can promote neuroregeneration; that is, the promotion of nerve tissue growth. This latter function has enabled scientific study based on animal test subjects to conceive that the peptide could play an instrumental role in the treatment of injuries relating to the central nervous system.

Other Beneficial Properties

Scientific study that has been based on animal test subjects has determined that the presence of IGF-1 DES 1,3 and its ability to promote hyperplasia could tie it to a few theorized benefits. The first of these particular benefits relates to an acceleration of muscle repair. Because IGF-1 DES 1,3’s mechanics allow it to initiate hyperplasia, scientific study based on animal test subjects has extended this ability to determine that the peptide can also increase the proliferation of cells that are needed to repair muscle tissue. Over time, this ability could turn into an ability to increase muscle growth. Another beneficial process can be tied to a slowing down of the aging process. Scientific study that has been based on lab rats has determined that IGF-1 DES 1,3’s ability to promote cell production slowed down the natural degradation of muscle fibers that regulate flexibility and elasticity in the skin and muscle. This process was shown to allow middle-aged and older rats to maintain a level of power and speed that was on par with similar functions found in younger rats. A third theorized benefit links IGF-1 DES 1,3 with the notion of an accelerated injury recovery rate. Scientific study that has been based on animal test subjects determined that IGF-1 DES 1,3’s capacity to promote cellular proliferation can cause a greater amount of cells to be produced in times when an animal test subject suffers an injury. As such, this type of proliferation can enable a much faster rate of healing to commence. Although there has been an extensive amount of research and study conducted in relation to IGF-1 DES 1,3 and its overall functionality, operational mechanics, and theorized benefits, it needs to be noted that all of the research that has been conducted and the subsequent results from such research has been solely built around the scientific study based on animal test subjects. Therefore, any findings or observations that relate to IGF-1 DES 1,3’s overall functionality, mechanics, or theoretical benefits, should only be contained to the strict confines of a controlled environment such as a medical research facility or a laboratory.

OUR ADVANTAGE

24x7 CUSTOMER SUPPORT

  • OUR WAREHOUSES are in Europe, USA, SINGAPORE, VIETNAM, THAILAND, UK, MALAYSIA

  • 24×7 online customer services 

  • HPLC and MS records for all of our products

  • The R&D center in the USA

  • OVER two decades experience in chemical and peptide industry

  • Producing as OEM /ODM with our customer labels

  • Accepting different currencies

  • 98.3% customer satisfaction in two decades

PACKING

Shipping

Our delivery solutions are as follow:
– Via Express services such as FedEx, EMS, DHL, TNT, USPS priority, UPS
– E-Commerce post service from the USA , Europe, Hongkong
– International Air freights for heavy packages over 50kg
– International ocean and rail freight for heavy packages over 200kg

ORANGE PEPTIDE FACTORY & LAB

OVER 10000 M2 production plant

We provide high-quality peptide synthesis service with a 99% peptide synthesis success rate, which is well above the industry standard of 75%. We are committed to Total Quality Management (TQM) to ensure our customers’ complete satisfaction. TQM includes MS and HPLC analyses performed after the completion of peptide synthesis, purification, and QC (quality control) steps. These analyses are followed by independent QA (quality assurance) procedures, which double guarantee the highest quality possible for every delivered peptide.

FAQ: 

A peptide that I purchased recently has less powder in it than others I’ve gotten. Does this mean it doesn’t have the right MG?

Peptides due to their nature come in a variety of sizes and shapes. Normally after the lyophilization process has completed we have a peptide that is in a perfect cake. However, there are times when it may break in transit or simply appear differently. This is no way affects the quality or potency of the product. It is simply an aesthetic issue. While we do try to always present a product that looks perfect, on occasion, this isn’t possible. Proteins such as IGF1 are very large in size and due to the requirement of a buffer will appear larger in size than a bpc157 or pt141. This is also normal.

What are the Purity Levels Of the peptides you Sell?

We will never sell a peptide that is less than 98% in purity from our catalog section. Many of our smaller peptide chains are well into the 99% purity range. We have manufacturing abilities that are quite often beyond the scope of smaller companies and therefore are able to achieve very high purity levels. Proteins such as IGF-1 LR3 are always receptor grade and always above 98% purity.

What are your products used for?

Peptides and Research serums are manufactured and sold to be used in a laboratory research setting. None of our products are intended for, nor are they manufactured for, diagnostic or therapeutic purposes in humans. Strong Peptide reserves the right to require additional verification of proper intent prior to fulfilling orders. Any orders that we feel aren’t for the specific intended purpose laid out in our Terms and Conditions will be denied.  Truthfully, if you are asking this question then you shouldn’t be ordering from us.

Will you test your powders after production?

Yes, We will test per batch in our laboratory, we will have HPLC, MS record for all of our products. We will check our peptides vial by vial before delivery.

Do you have GMP lab ?

Yes, we have GMP lab, and we have a fully automatic production line. We could produce all of our peptides with the automtic sealing machine. We are able to offer vacuum sealed vials.

Do you have wholesale prices?

We have special prices for our distributors and wholesale customers. We could produce as OEM with customized box, label, cap colors, For more information please contact us

CONTACT US: 


    Please prove you are human by selecting the house.

    Reviews

    There are no reviews yet.

    Be the first to review “Wholesale IGF1 DES 2MG -50vials”

    Start typing and press Enter to search

    Shopping Cart